Jump to content

SecStrAnnotator:SecStrAPI: Difference between revisions

From WebChemistry Wiki
Midlik (talk | contribs)
Midlik (talk | contribs)
 
(8 intermediate revisions by the same user not shown)
Line 1: Line 1:
The [https://webchem.ncbr.muni.cz/API/SecStr '''SecStrAPI'''] allows programmatic access to precomputed secondary structure annotations.
[[File:SecStrAnnotator-SecStrAPI-plugin.png | thumb | right | 600px | Example of using SecStrAPI plugin in PyMOL:
<br><code><nowiki>> run https://webchem.ncbr.muni.cz/API/SecStr/Downloads/secstrapi_plugin.py</nowiki></code>
<br><code>> annotate_sec_str 1tqn</code>]]
 
The [https://webchem.ncbr.muni.cz/API/SecStr '''SecStrAPI'''] allows programmatic access to precomputed secondary structure annotations. The annotations from SecStrAPI can also be easily visualized in PyMOL using [https://webchem.ncbr.muni.cz/API/SecStr/Downloads/secstrapi_plugin.py SecStrAPI Plugin].
 


== Requests ==
== Requests ==
Line 19: Line 24:


</ul>
</ul>


== SecStrAPI format ==
== SecStrAPI format ==


The annotations are provided in SecStrAPI JSON format, demonstrated below.
The annotations are provided in SecStrAPI JSON format, demonstrated and explained below.


<source lang="json">
<source lang="json">


{
{
     "api_version": "1.0",                     # pdb-style residue range (auth_seq_id), ":" stands for the whole chain
     "api_version": "1.0",                          
     "annotations": {                         # pdb-style residue range (auth_seq_id), ":" stands for the whole chain
     "annotations": {
         "1tqn": {
         "1tqn": {                                   # PDB ID
             "1tqnA": {
             "1tqnA": {                             # domain ID (unique domain identifier in SecStrAPI)
                 "pdb": "1tqn",
                 "pdb": "1tqn",                     # PDB ID
                 "chain_id": "A",
                 "chain_id": "A",                   # mmcif-style chain identifier (label_asym_id)
                 "ranges": ":",
                 "ranges": ":",                     # mmcif-style residue range (label_seq_id), : stands for the whole chain
                 "auth_chain_id": "A",
                 "auth_chain_id": "A",               # pdb-style chain identifier (auth_asym_id)
                 "auth_ranges": ":",
                 "auth_ranges": ":",                 # pdb-style residue range (auth_seq_id), : stands for the whole chain
                 "uniprot_id": "P08684",
                 "uniprot_id": "P08684",             # UniProt accession number
                 "uniprot_name": "CP3A4_HUMAN",
                 "uniprot_name": "CP3A4_HUMAN",     # UniProt mnemonic identifier
                 "domain_mappings": [
                 "domain_mappings": [               # list of mappings to source databases
                     {
                     {
                         "domain": "1tqnA00",
                         "domain": "1tqnA00",       # domain ID in the source database, if available
                         "source": "CATH",
                         "source": "CATH",           # name of source database
                         "family": "1.10.630.10",
                         "family": "1.10.630.10",   # family ID in the source database
                         "pdb": "1tqn",
                         "pdb": "1tqn",             # PDB ID
                         "chain_id": "A",
                         "chain_id": "A",           # mmcif-style chain identifier (label_asym_id) of the domain in the source database
                         "ranges": "7:478"
                         "ranges": "7:478"           # mmcif-style residue range (label_seq_id) of the domain in the source database (including the number before and after the colon)
                     },
                     },
                     {
                     {
Line 56: Line 62:
                     }
                     }
                 ],
                 ],
                 "secondary_structure_elements": [
                 "secondary_structure_elements": [   # list of annotated secondary structure elements (SSEs)
                     {
                     {
                         "label": "A'",
                         "label": "1-1",             # SSE label
                         "chain_id": "A",
                         "chain_id": "A",           # mmcif-style chain identifier (label_asym_id)
                         "start": 29,
                         "start": 50,               # mmcif-style residue number of the first residue (label_seq_id)
                         "end": 32,
                         "end": 55,                 # mmcif-style residue number of the last residue (label_seq_id)
                         "auth_chain_id": "A",
                         "auth_chain_id": "A",       # pdb-style chain identifier (auth_asym_id)
                         "auth_start": 50,
                         "auth_start": 71,           # pdb-style residue number of the first residue (auth_seq_id)
                         "auth_start_ins_code": "",
                         "auth_start_ins_code": "", # residue insertion code of the first residue (pdbx_PDB_ins_code)
                         "auth_end": 53,
                         "auth_end": 76,             # pdb-style residue number of the last residue (auth_seq_id)
                         "auth_end_ins_code": "",
                         "auth_end_ins_code": "",   # residue insertion code of the last residue (pdbx_PDB_ins_code)
                         "type": "h",
                         "type": "e",                # SSE type (h: helix, e: beta-strand)
                         "color": "s121",
                        "sheet_id": 1,             # beta-sheet identifier (all strands in the same sheet have the same sheet_id)
                         "metric_value": 8.54,
                         "color": "s164",           # pymol-style color assigned to this SSE (consistent through the whole family)
                         "confidence": "high",
                         "metric_value": 2.5,       # measure of deviation from the template
                         "sequence": "ILSY"
                         "confidence": "high",       # confidence of the annotation (high: metric_value <= 10, medium: 10 < metric_value <= 20, low: metric_value > 20)
                         "sequence": "VWGFYD"       # amino acid sequence of the SSE
                     },
                     },
                     {
                     {
                         "label": "A",
                         "label": "1-2",
                         "chain_id": "A",
                         "chain_id": "A",
                         "start": 36,
                         "start": 58,
                         "end": 47,
                         "end": 63,
                         "auth_chain_id": "A",
                         "auth_chain_id": "A",
                         "auth_start": 57,
                         "auth_start": 79,
                         "auth_start_ins_code": "",
                         "auth_start_ins_code": "",
                         "auth_end": 68,
                         "auth_end": 84,
                         "auth_end_ins_code": "",
                         "auth_end_ins_code": "",
                         "type": "h",
                         "type": "e",
                         "color": "s143",
                        "sheet_id": 1,
                         "metric_value": 2.98,
                         "color": "s186",
                         "metric_value": 2.03,
                         "confidence": "high",
                         "confidence": "high",
                         "sequence": "FCMFDMECHKKY"
                         "sequence": "QPVLAI"
                     },
                     },
                     {
                     {
Line 104: Line 112:
                         "confidence": "high",
                         "confidence": "high",
                         "sequence": "PDMIKTVLVKE"
                         "sequence": "PDMIKTVLVKE"
                    },
                    {
                        "label": "B'",
                        "chain_id": "A",
                        "start": 91,
                        "end": 95,
                        "auth_chain_id": "A",
                        "auth_start": 112,
                        "auth_start_ins_code": "",
                        "auth_end": 116,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s251",
                        "metric_value": 16.26,
                        "confidence": "medium",
                        "sequence": "GFMKS"
                    },
                    {
                        "label": "C",
                        "chain_id": "A",
                        "start": 102,
                        "end": 116,
                        "auth_chain_id": "A",
                        "auth_start": 123,
                        "auth_start_ins_code": "",
                        "auth_end": 137,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s294",
                        "metric_value": 1.67,
                        "confidence": "high",
                        "sequence": "DEEWKRLRSLLSPTF"
                    },
                    {
                        "label": "D",
                        "chain_id": "A",
                        "start": 118,
                        "end": 145,
                        "auth_chain_id": "A",
                        "auth_start": 139,
                        "auth_start_ins_code": "",
                        "auth_end": 166,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s316",
                        "metric_value": 13.92,
                        "confidence": "medium",
                        "sequence": "SGKLKEMVPIIAQYGDVLVRNLRREAET"
                    },
                    {
                        "label": "E",
                        "chain_id": "A",
                        "start": 151,
                        "end": 167,
                        "auth_chain_id": "A",
                        "auth_start": 172,
                        "auth_start_ins_code": "",
                        "auth_end": 188,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s359",
                        "metric_value": 2.49,
                        "confidence": "high",
                        "sequence": "LKDVFGAYSMDVITSTS"
                    },
                    {
                        "label": "F",
                        "chain_id": "A",
                        "start": 181,
                        "end": 189,
                        "auth_chain_id": "A",
                        "auth_start": 202,
                        "auth_start_ins_code": "",
                        "auth_end": 210,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s381",
                        "metric_value": 17.99,
                        "confidence": "medium",
                        "sequence": "PFVENTKKL"
                    },
                    {
                        "label": "F'",
                        "chain_id": "A",
                        "start": 197,
                        "end": 205,
                        "auth_chain_id": "A",
                        "auth_start": 218,
                        "auth_start_ins_code": "",
                        "auth_end": 226,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s402",
                        "metric_value": 3.86,
                        "confidence": "high",
                        "sequence": "PFFLSITVF"
                    },
                    {
                        "label": "G'",
                        "chain_id": "A",
                        "start": 206,
                        "end": 215,
                        "auth_chain_id": "A",
                        "auth_start": 227,
                        "auth_start_ins_code": "",
                        "auth_end": 236,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s424",
                        "metric_value": 13.51,
                        "confidence": "medium",
                        "sequence": "PFLIPILEVL"
                    },
                    {
                        "label": "G",
                        "chain_id": "A",
                        "start": 222,
                        "end": 242,
                        "auth_chain_id": "A",
                        "auth_start": 243,
                        "auth_start_ins_code": "",
                        "auth_end": 263,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s445",
                        "metric_value": 15.71,
                        "confidence": "medium",
                        "sequence": "REVTNFLRKSVKRMKESRLED"
                    },
                    {
                        "label": "H",
                        "chain_id": "A",
                        "start": 250,
                        "end": 259,
                        "auth_chain_id": "A",
                        "auth_start": 271,
                        "auth_start_ins_code": "",
                        "auth_end": 280,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s467",
                        "metric_value": 6.91,
                        "confidence": "high",
                        "sequence": "FLQLMIDSQN"
                    },
                    {
                        "label": "I",
                        "chain_id": "A",
                        "start": 271,
                        "end": 303,
                        "auth_chain_id": "A",
                        "auth_start": 292,
                        "auth_start_ins_code": "",
                        "auth_end": 324,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s532",
                        "metric_value": 1.54,
                        "confidence": "high",
                        "sequence": "DLELVAQSIIFIFAGYETTSSVLSFIMYELATH"
                    },
                    {
                        "label": "J",
                        "chain_id": "A",
                        "start": 304,
                        "end": 318,
                        "auth_chain_id": "A",
                        "auth_start": 325,
                        "auth_start_ins_code": "",
                        "auth_end": 339,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s554",
                        "metric_value": 1.52,
                        "confidence": "high",
                        "sequence": "PDVQQKLQEEIDAVL"
                    },
                    {
                        "label": "J'",
                        "chain_id": "A",
                        "start": 326,
                        "end": 331,
                        "auth_chain_id": "A",
                        "auth_start": 347,
                        "auth_start_ins_code": "",
                        "auth_end": 352,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s575",
                        "metric_value": 5.71,
                        "confidence": "high",
                        "sequence": "YDTVLQ"
                    },
                    {
                        "label": "K",
                        "chain_id": "A",
                        "start": 333,
                        "end": 346,
                        "auth_chain_id": "A",
                        "auth_start": 354,
                        "auth_start_ins_code": "",
                        "auth_end": 367,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s597",
                        "metric_value": 1.55,
                        "confidence": "high",
                        "sequence": "EYLDMVVNETLRLF"
                    },
                    {
                        "label": "K'",
                        "chain_id": "A",
                        "start": 377,
                        "end": 382,
                        "auth_chain_id": "A",
                        "auth_start": 398,
                        "auth_start_ins_code": "",
                        "auth_end": 403,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s727",
                        "metric_value": 2.0,
                        "confidence": "high",
                        "sequence": "SYALHR"
                    },
                    {
                        "label": "K''",
                        "chain_id": "A",
                        "start": 395,
                        "end": 398,
                        "auth_chain_id": "A",
                        "auth_start": 416,
                        "auth_start_ins_code": "",
                        "auth_end": 419,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s748",
                        "metric_value": 1.79,
                        "confidence": "high",
                        "sequence": "PERF"
                    },
                    {
                        "label": "L",
                        "chain_id": "A",
                        "start": 424,
                        "end": 441,
                        "auth_chain_id": "A",
                        "auth_start": 445,
                        "auth_start_ins_code": "",
                        "auth_end": 462,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s770",
                        "metric_value": 0.78,
                        "confidence": "high",
                        "sequence": "MRFALMNMKLALIRVLQN"
                    },
                    {
                        "label": "1-1",
                        "chain_id": "A",
                        "start": 50,
                        "end": 55,
                        "auth_chain_id": "A",
                        "auth_start": 71,
                        "auth_start_ins_code": "",
                        "auth_end": 76,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s164",
                        "metric_value": 2.5,
                        "confidence": "high",
                        "sequence": "VWGFYD"
                    },
                    {
                        "label": "1-2",
                        "chain_id": "A",
                        "start": 58,
                        "end": 63,
                        "auth_chain_id": "A",
                        "auth_start": 79,
                        "auth_start_ins_code": "",
                        "auth_end": 84,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s186",
                        "metric_value": 2.03,
                        "confidence": "high",
                        "sequence": "QPVLAI"
                    },
                    {
                        "label": "1-5",
                        "chain_id": "A",
                        "start": 83,
                        "end": 83,
                        "auth_chain_id": "A",
                        "auth_start": 104,
                        "auth_start_ins_code": "",
                        "auth_end": 104,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s229",
                        "metric_value": 5.55,
                        "confidence": "high",
                        "sequence": "N"
                    },
                    {
                        "label": "3-1",
                        "chain_id": "A",
                        "start": 149,
                        "end": 150,
                        "auth_chain_id": "A",
                        "auth_start": 170,
                        "auth_start_ins_code": "",
                        "auth_end": 171,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s337",
                        "metric_value": 6.76,
                        "confidence": "high",
                        "sequence": "VT"
                    },
                    {
                        "label": "1-4",
                        "chain_id": "A",
                        "start": 352,
                        "end": 355,
                        "auth_chain_id": "A",
                        "auth_start": 373,
                        "auth_start_ins_code": "",
                        "auth_end": 376,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s640",
                        "metric_value": 10.06,
                        "confidence": "medium",
                        "sequence": "LERV"
                    },
                    {
                        "label": "2-1",
                        "chain_id": "A",
                        "start": 360,
                        "end": 362,
                        "auth_chain_id": "A",
                        "auth_start": 381,
                        "auth_start_ins_code": "",
                        "auth_end": 383,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s662",
                        "metric_value": 2.42,
                        "confidence": "high",
                        "sequence": "VEI"
                    },
                    {
                        "label": "2-2",
                        "chain_id": "A",
                        "start": 365,
                        "end": 367,
                        "auth_chain_id": "A",
                        "auth_start": 386,
                        "auth_start_ins_code": "",
                        "auth_end": 388,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s683",
                        "metric_value": 3.0,
                        "confidence": "high",
                        "sequence": "MFI"
                    },
                    {
                        "label": "1-3",
                        "chain_id": "A",
                        "start": 372,
                        "end": 375,
                        "auth_chain_id": "A",
                        "auth_start": 393,
                        "auth_start_ins_code": "",
                        "auth_end": 396,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s705",
                        "metric_value": 1.95,
                        "confidence": "high",
                        "sequence": "VVMI"
                    },
                    {
                        "label": "3-3",
                        "chain_id": "A",
                        "start": 442,
                        "end": 445,
                        "auth_chain_id": "A",
                        "auth_start": 463,
                        "auth_start_ins_code": "",
                        "auth_end": 466,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s791",
                        "metric_value": 1.6,
                        "confidence": "high",
                        "sequence": "FSFK"
                    },
                    {
                        "label": "4-1",
                        "chain_id": "A",
                        "start": 456,
                        "end": 456,
                        "auth_chain_id": "A",
                        "auth_start": 477,
                        "auth_start_ins_code": "",
                        "auth_end": 477,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s835",
                        "metric_value": 12.71,
                        "confidence": "medium",
                        "sequence": "L"
                    },
                    {
                        "label": "4-2",
                        "chain_id": "A",
                        "start": 464,
                        "end": 464,
                        "auth_chain_id": "A",
                        "auth_start": 485,
                        "auth_start_ins_code": "",
                        "auth_end": 485,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s878",
                        "metric_value": 9.03,
                        "confidence": "high",
                        "sequence": "P"
                    },
                    {
                        "label": "3-2",
                        "chain_id": "A",
                        "start": 469,
                        "end": 474,
                        "auth_chain_id": "A",
                        "auth_start": 490,
                        "auth_start_ins_code": "",
                        "auth_end": 495,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "color": "s900",
                        "metric_value": 6.31,
                        "confidence": "high",
                        "sequence": "VLKVES"
                     }
                     }
                 ],
                 ],
                 "beta_connectivity": [
                 "beta_connectivity": [             # list of connections between strands in beta-sheets
                    [
                        "1-1",
                        "1-2",
                        -1
                    ],
                    [
                        "1-2",
                        "1-3",
                        1
                    ],
                    [
                        "1-5",
                        "1-4",
                        -1
                    ],
                    [
                        "3-1",
                        "3-2",
                        -1
                    ],
                    [
                        "1-4",
                        "1-3",
                        -1
                    ],
                    [
                        "2-1",
                        "2-2",
                        -1
                    ],
                    [
                        "3-3",
                        "3-2",
                        -1
                    ],
                     [
                     [
                         "4-1",
                         "1-1",                     # label of the first strand
                         "4-2",
                         "1-2",                     # label of the second strand
                         -1
                         -1                         # relative orientation of the strands (1: parallel, -1: antiparallel)
                     ]
                     ]
                 ],
                 ],
                 "rotation_matrix": [
                 "rotation_matrix": [               # PyMOL object matrix used to align the domain to the template
                     0.0841438366722304,
                     0.0841438366722304,
                     -0.9907657680912565,
                     -0.9907657680912565,

Latest revision as of 15:31, 9 April 2020

Example of using SecStrAPI plugin in PyMOL:
> run https://webchem.ncbr.muni.cz/API/SecStr/Downloads/secstrapi_plugin.py
> annotate_sec_str 1tqn

The SecStrAPI allows programmatic access to precomputed secondary structure annotations. The annotations from SecStrAPI can also be easily visualized in PyMOL using SecStrAPI Plugin.


Requests


SecStrAPI format

The annotations are provided in SecStrAPI JSON format, demonstrated and explained below.

{
    "api_version": "1.0",                           
    "annotations": {
        "1tqn": {                                   # PDB ID
            "1tqnA": {                              # domain ID (unique domain identifier in SecStrAPI)
                "pdb": "1tqn",                      # PDB ID
                "chain_id": "A",                    # mmcif-style chain identifier (label_asym_id)
                "ranges": ":",                      # mmcif-style residue range (label_seq_id), : stands for the whole chain
                "auth_chain_id": "A",               # pdb-style chain identifier (auth_asym_id)
                "auth_ranges": ":",                 # pdb-style residue range (auth_seq_id), : stands for the whole chain
                "uniprot_id": "P08684",             # UniProt accession number
                "uniprot_name": "CP3A4_HUMAN",      # UniProt mnemonic identifier
                "domain_mappings": [                # list of mappings to source databases
                    {
                        "domain": "1tqnA00",        # domain ID in the source database, if available
                        "source": "CATH",           # name of source database
                        "family": "1.10.630.10",    # family ID in the source database
                        "pdb": "1tqn",              # PDB ID
                        "chain_id": "A",            # mmcif-style chain identifier (label_asym_id) of the domain in the source database
                        "ranges": "7:478"           # mmcif-style residue range (label_seq_id) of the domain in the source database (including the number before and after the colon)
                    },
                    {
                        "domain": null,
                        "source": "Pfam",
                        "family": "PF00067",
                        "pdb": "1tqn",
                        "chain_id": "A",
                        "ranges": "17:472"
                    }
                ],
                "secondary_structure_elements": [   # list of annotated secondary structure elements (SSEs)
                    {
                        "label": "1-1",             # SSE label
                        "chain_id": "A",            # mmcif-style chain identifier (label_asym_id)
                        "start": 50,                # mmcif-style residue number of the first residue (label_seq_id)
                        "end": 55,                  # mmcif-style residue number of the last residue (label_seq_id)
                        "auth_chain_id": "A",       # pdb-style chain identifier (auth_asym_id)
                        "auth_start": 71,           # pdb-style residue number of the first residue (auth_seq_id)
                        "auth_start_ins_code": "",  # residue insertion code of the first residue (pdbx_PDB_ins_code)
                        "auth_end": 76,             # pdb-style residue number of the last residue (auth_seq_id)
                        "auth_end_ins_code": "",    # residue insertion code of the last residue (pdbx_PDB_ins_code)
                        "type": "e",                # SSE type (h: helix, e: beta-strand)
                        "sheet_id": 1,              # beta-sheet identifier (all strands in the same sheet have the same sheet_id)
                        "color": "s164",            # pymol-style color assigned to this SSE (consistent through the whole family)
                        "metric_value": 2.5,        # measure of deviation from the template
                        "confidence": "high",       # confidence of the annotation (high: metric_value <= 10, medium: 10 < metric_value <= 20, low: metric_value > 20)
                        "sequence": "VWGFYD"        # amino acid sequence of the SSE
                    },
                    {
                        "label": "1-2",
                        "chain_id": "A",
                        "start": 58,
                        "end": 63,
                        "auth_chain_id": "A",
                        "auth_start": 79,
                        "auth_start_ins_code": "",
                        "auth_end": 84,
                        "auth_end_ins_code": "",
                        "type": "e",
                        "sheet_id": 1,
                        "color": "s186",
                        "metric_value": 2.03,
                        "confidence": "high",
                        "sequence": "QPVLAI"
                    },
                    {
                        "label": "B",
                        "chain_id": "A",
                        "start": 66,
                        "end": 76,
                        "auth_chain_id": "A",
                        "auth_start": 87,
                        "auth_start_ins_code": "",
                        "auth_end": 97,
                        "auth_end_ins_code": "",
                        "type": "h",
                        "color": "s208",
                        "metric_value": 3.83,
                        "confidence": "high",
                        "sequence": "PDMIKTVLVKE"
                    }
                ],
                "beta_connectivity": [              # list of connections between strands in beta-sheets
                    [
                        "1-1",                      # label of the first strand
                        "1-2",                      # label of the second strand
                        -1                          # relative orientation of the strands (1: parallel, -1: antiparallel)
                    ]
                ],
                "rotation_matrix": [                # PyMOL object matrix used to align the domain to the template
                    0.0841438366722304,
                    -0.9907657680912565,
                    -0.10631560341088532,
                    -0.46321294579603234,
                    0.04653041207831938,
                    -0.10267083975128484,
                    0.99362649895048,
                    -0.12159261906614163,
                    -0.995366633709358,
                    -0.08855445467795255,
                    0.03746162109134595,
                    0.05273612685656731,
                    18.78404164503984,
                    23.992462979534775,
                    13.616655034021722,
                    1.0
                ],
                "comment": "Automatic annotation for 1tqn based on 2NNJ template. Program was called with these parameters: /home/adam/Workspace/C#/SecStrAnnot2_data/SecStrAPI/CytochromesP450-20200128/structures 2NNJ,A,: 1tqn,A,: --soft --label2auth --maxmetric 25,0.5,0.5 --verbose  Total value of used metric: 186.50"
            }
        }
    }
}



Back to the main page